GenomeNet

>rsh:Rsph17029_2940 ribulose 1,5-bisphosphate carboxylase small subunit (EC:4.1.1.39); K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] (A)
MRITQGCFSFLPDLTDAQISAQVDYCLGRGWAVSLEHTDDPHPRNTYWEMWGMPMFDLRD
PKGVMIELDECRKAWPGRYIRINAFDSTRGFETVTMSFIVNRPEVEPSLRMERTEVDGRS
IRYTHSIVR

BLAST