GenomeNet

>rsh:Rsph17029_3839 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) Glutathione S-transferase, C-terminal domain (A)
MPHGKVADMLELFAHPFSSYCQKVWIALHEYGLEARHRMLSPEEPENIELLAGFWPFRKM
PLLLDDGRPVSEASIIVEHLTLHHARGPRLIPEDPVAALEVRFWDRFFDNYVATPQQKIV
FDAMRPEEARDPAGVAEARAMLETAYGLLERHLPGRTWVAGERFSLADCSAAPQLFYADW
THPVGEGFPLVAAYRARLNARPSMARCIEAARPWRPYFPLGAPDRD

BLAST