GenomeNet

>rsk:RSKD131_3290 Glutathione S-transferase, C-terminal domain protein; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MDRPGLTVTAFDWVPGFAQGQVRDLRPRWALEEAELPYEVELLPQGAQETPEHLARQPFG
QVPVLTLDGRSMFESGACVWRIAERSERLLPRDPGLRDSCLSWVIAALNTLEPPIMMMGM
LWFFERWPDTFGLEDREAPGKVRGPARGMLDKRLAQFGRALAGRETIVGDGFTVADLMLT
CVLLPAAQMDLLGAHPEVKAYYDRHSARPGFRKAQADQIAAFAENAGKYRAA

BLAST