GenomeNet

>rsk:RSKD131_4141 K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] | (GenBank) ribulose bisphosphate carboxylaseoxygenase,large subunit (A)
MIRASYIVETPCPIAEVAAMMAGEQSAGTFVRVEGETDALRARFGARVVETAEIGRSERP
SLRSAWAERRGLTGPRGLYRVVIDYPEENVGVNLPTLAAVVAGNLYDLGEVTGLKLMDVT
LDPAYRARYESPAMALAGTRASLGVPSRPIFGTIIKPNIGLDPDEIAALVARLCEAGADF
IKDDEIAGTHPHAPVDARIRAVMREVRRHRDRTGRLVMVAFNISDETDAMRRHADLIAAE
EGSCAMVSLNWCGLGAVQTLRRHTGLAIHGHRNGFGGMGRHPLLGMGVQAYQTLYRLAGI
DHMHVHGMGGKFSDLDEDVAEAARHCLTGLGPADDRVMPVFSSGQWAGTLPHTLAETRSD
ELMFLCGGGIMAHPGGPAAGLASLRQAHDAVRAGLDLAEAARDRPELAAALAAFGSGR

BLAST