GenomeNet

>rsl:RPSI07_mp0202 K05343 maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1] | (GenBank) TreS; Trehalose synthase, Maltose alpha-D-glucosyltransferase; Alpha amylase, catalytic subdomain (EC:5.4.99.16) (A)
MTRNPTVLLVDDALWYKDAVIYQLHVKSFCDSNNDGVGDLPGLISKLDYIAELGVDAVWL
LPFYPSPRRDDGYDIADYRGVHPDYGTMADARRFIAEAHARGLRVITELVINHTSDQHPW
FQRARRAKSGSALRDFYVWSDHDKKYAGTRIIFIDTEPSNWTWDPVANAYYWHRFYSHQP
DLNFDNPRVLKAVLGVMKFWLNLGVDGLRLDAVPYLVEREGTANENLPETHAVLRKIRAA
MDAEFKNRLLLAEANQWPEDTQEYFGDGDECHMAFHFPLMPRMYMAIAREDRFPITDIMR
QTPEVPSACQWAIFLRNHDELTLEMVTDAERDYLWEVYASDRRARLNLGIRRRLAPLLER
DRRRVELMNSLLFSMPGTPVMYYGDEIGMGDNIHLGDRDGVRTPMQWSPDRNGGFSRADP
EQLVLPAIMGSLYGYESVNVEAQTRDAHSLLNWTRRMLATRKRHRVFGRGSIQFLHPANR
KVLAYVRALEGEAPILCVANLSRASQAVELDLAAYAQRVPVELIGGTAFPPIGQLPYLLT
LPPYAFYWLELRENEPGPSWAQPAAEQLPEFTTLVLRAGLDALSDTRQREAHRQLIEREI
LPSYLPKRRWFAAKDSVLRGAHFVWGATVPVDASSTNRPLAGATRPEIFINEIAVTLGDA
DGTERTERYLLPLSIAWESATLPALPIQLALARVRRGRHVGYLTDAFTTETFARALLAGL
VRGVTLEANEGTVRFEPEPNLVEPAEPAPEADAGAARPAPLPLAPDAPVRWLAAEQSNSS
LVIGESIIVKLIRRVAAGVHPEVEMTRHLTRIGYANTAALIGEIAHVSAAGERSTLAVIQ
SFVPNQGDAWTWALDYLRRTIDELAVLTEAVSTGDGEAAPAAVSEARTDTDEALAGYLAF
IGGIGTRLGELHVALASPSKDAAFGTSAANADDAAYWIACVSEQVTRALDHLAAWQAING
SNADLDWLLSQRDALLAAARERAQGGLGALLARIHGDFHLGQVLVAQGDAFLIDFEGEPS
RPVEERRRKTSPLRDVAGLVRSLDYVVGAMRQGPEHVAGPAQERRDQLLERFRNASTERF
LDAYAAAVQAPESDDGACALDMDLLDLFLLEKAAYEVNYEAANRPSWLPIPLTGLARVAR
RLLHAEVPSPAVQDPPGGPP

BLAST