GenomeNet

>rsn:RSPO_c02379 glutathione s-transferase protein; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
METTMDRAATFELEMTRHIRAPRERVFDAFTDQAALAAWHCPRGMGVLEASADPRVGGQY
RVVMGGRDGSRHIAVGEYQKLDRADFLAYTWAWESGSMPPELKTLIEVTLTDQDGGTRLH
MRHSGFPDMQARNGHLAGWQSVFNRLSDYLDPEGSAGTVTVYGDPRSSYCRTVRMALAEK
GVRYALQPVPPHSPELLTHNPFGRVPAFSDGPIEFYETRAILSYIDEAFDGPSLLPQWGA
TAHARGEQWISLINCHAYDAMVRRYVLQYIFPKGENGQPDRKVIDGALPEIAAQLDALEQ
AYDDRDYLVGSTVSMADLFLAPILAYLGMFPEGAALLEKRPNLQRGQAVMRARPSFAATQ
PQLG

BLAST