GenomeNet

>rsn:RSPO_c02606 K01556 kynureninase [EC:3.7.1.3] | (GenBank) kynU; kynureninase protein (A)
MTLTRNTCLERDAADPIAPLRDAFALPDGVIYLDGNSLGARPRAALARAQQVVADEWGEG
LIRSWNQSGWFDLPRRLGNKLAPLIGARPDEVVVTDTTSINLFKVLAAALRVQREDAPER
KIIVSETHNFPTDLYIAEGLADLLRDGYKLRLIDAPDELEAALGDDVAVTMLTHVNYKSG
HMYDMAAVSALAHRHGALAVWDLAHSAGAVPVDLHAGGADYAIGCTYKYLNGGPGSPAFV
WVSPALRERFWQPLSGWWGHARPFAMESRYDAGAGIGRFLCGTQPITSMAMVECGLDLFA
QTSMAALRAKSLALTDLFIELIETRCAGYPLTLATPRDHAVRGSHVSYAHPDGFAVMQAL
IARGVIGDYREPHIMRFGFTPLYTRFVDVWDAVEVLRDVLETGAWQSAQFNERTLVT

BLAST