GenomeNet

>rsn:RSPO_c02606 kynU; kynureninase protein; K01556 kynureninase [EC:3.7.1.3] (A)
MTLTRNTCLERDAADPIAPLRDAFALPDGVIYLDGNSLGARPRAALARAQQVVADEWGEG
LIRSWNQSGWFDLPRRLGNKLAPLIGARPDEVVVTDTTSINLFKVLAAALRVQREDAPER
KIIVSETHNFPTDLYIAEGLADLLRDGYKLRLIDAPDELEAALGDDVAVTMLTHVNYKSG
HMYDMAAVSALAHRHGALAVWDLAHSAGAVPVDLHAGGADYAIGCTYKYLNGGPGSPAFV
WVSPALRERFWQPLSGWWGHARPFAMESRYDAGAGIGRFLCGTQPITSMAMVECGLDLFA
QTSMAALRAKSLALTDLFIELIETRCAGYPLTLATPRDHAVRGSHVSYAHPDGFAVMQAL
IARGVIGDYREPHIMRFGFTPLYTRFVDVWDAVEVLRDVLETGAWQSAQFNERTLVT

BLAST