GenomeNet

>rso:RSc1371 K01775 alanine racemase [EC:5.1.1.1] | (GenBank) dadX; probable alanine racemase protein (EC:5.1.1.1) (A)
MPRPIQAVIHGPALVNNLQVVRRHAADSRVWAVIKANAYGHGIERAYEGLRQADGFGLLD
LDEAVRLRQLGWQGPILLLEGFFKPEDLALVEQYRLTTTVHCEEQLRMLELARLKGPVSI
QLKINTGMSRLGFAPAAYRAAWEHARAISGIGTIVHMTHFSDADGPRGIDHQLAAFEQAT
QGLPGEASLSNSAATLWHPRAHRDWVRPGVILYGASPTGVAADIEGTGLMPAMTLKSELI
AVQDLQPGATVGYGSRFEAEQPMRIGIVACGYADGYPRHAPGWDGNYTPVLVDGVRTRMV
GRVSMDMITVDLAEVPGARVGAPVTLWGQGLPIDEVAHAAGTVGYELMCALAPRVPVTVE
PAGAADAGETLGKAA

BLAST