GenomeNet

>rso:RSc2021 GST-related protein (EC:2.5.1.18); K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MIDVYSWATPNGHKVHIMLEECGLPYRVHAVNIGAGDQFKPEFLKISPNNKIPAIVDQDG
PDGQPISLFESGAILLYLAGKTGKFLPEDVRGKYEVLQWLMFQMGGVGPMLGQTHHFRIY
APEKIDYAINRYTNEAKRLYGVIDKRLSESKYLGGPDYSIADIATWPWLRSWQNQGIVLS
DYPRLQRWFEAIEARPAVQRAVKVLAKERSPLQDDKEREVLFGATQYARR

BLAST