GenomeNet

>rso:RSc2021 K11209 GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-] | (GenBank) gstI; probable glutathione-s-transferase protein (A)
MIDVYSWATPNGHKVHIMLEECGLPYRVHAVNIGAGDQFKPEFLKISPNNKIPAIVDQDG
PDGQPISLFESGAILLYLAGKTGKFLPEDVRGKYEVLQWLMFQMGGVGPMLGQTHHFRIY
APEKIDYAINRYTNEAKRLYGVIDKRLSESKYLGGPDYSIADIATWPWLRSWQNQGIVLS
DYPRLQRWFEAIEARPAVQRAVKVLAKERSPLQDDKEREVLFGATQYARR

BLAST