GenomeNet

>rso:RSc2358 K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] | (GenBank) ppc; probable phosphoenolpyruvate carboxylase (pepcase) (pepc) protein (EC:4.1.1.31) (A)
MTQSAARRASSRATPARKTPPAPASQTPAPSPGGTAGTALGPTSRRSSGSAAAKDQPLKE
DIRFLGRLLGDVLREQEGAAAFETVETIRQTAVRFRRDGDRQAEQELDRLLKTLSRDQTT
SVVRAFSYFSHLANIAEDQHHNRRRRVHALAGSSPQPGSLLRALLSAADEGLSGDALRRF
FDAALIVPVLTAHPTEVQRKSILDAQREIARLLAERDAPLTVRERERNVTLLRAHVTKLW
QTRMLRTTRLMVADEIENALSYYQTTFLREIPALYRELEEDVATVFPRRGARGEPAPLPA
FFQMGSWIGGDRDGNPFVTAQTLRHAAQRQASVILTWYLDEIHALGAELSMSTLLVDVSA
DLLALAERSPDHSEHRADEPYRRALIGVYARLAATCRELTGEDAGRHAVGPAPAYTRAEE
LRADLQIVIDSLAAHHGEALADARLASLARAIDVFGFHLASIDLRQVSDVHEATVAELLR
VAGVEGAYAALSEADKRTLLLRELQQPRLLTLPFHTYSETTASELDIFRAAREVRARYGS
RIVRNYIISHTETLSDLLEVMLLQKEAGMFRHGTNGSGGAGLDVMVIPLFETIEDLRNAP
QIMGELLALPGFDAVLAAQGNEQEVMLGYSDSNKDGGFLTSNWELYKTELALVELFERKG
VRLRLFHGRGGTVGRGGGPTYQAILSQPPGTVNGQIRLTEQGEIISSKFANPEIGRRNLE
TIVAATLEATLLPTRNRPKGLEEFEAAMQALSDHAFSAYRHLVYETPGFKDYFFATTPIT
EIADLNLGSRPASRKLMDRKQRRIEDLRAIPWGFSWGQCRLLLPGWFGFGSAVQRWLDEA
GSAKAKAARLATLKRMHKQWPFFANLLSNMDMVLSKADLNVASRYAQLCEDRKLRNAVFS
RISAEFTLTEQVLGAITGQSERLADNPLLARSIKNRFPYLDPLNHLQVELLKRFRSGKAG
SNDARVRRGIHLSINGIAAGLRNSG

BLAST