GenomeNet

>rso:RSc2842 ddl; probable d-alanine--d-alanine ligase (d-alanylalanine synthetase)(d-ala-d-ala ligase) protein (EC:6.3.2.4); K01921 D-alanine-D-alanine ligase [EC:6.3.2.4] (A)
MTTGPFVPHPTLDPKSLGKVGVILGGRSAEREISLLSGNGVLAALRSRGVDAHPFDPGTQ
PVAGLAAQGFHRVVISLHGRFGEDGTIQGLLEQFGIPYTGSGVLASALAMDKEATKRLWQ
THSLPTPDFVMLHAGADWQAVADRLGLPLIVKPAREGSSIGLTKVTSVAELPAAYEKAAR
LDRDVMAEQFIDGDELTCAVIGEGEHATALPLIRIVAPQANYDYQHKYFTDDTRYECPAP
IPAEAAARVQALVVQAYRSLGCRGWGRADIMLRKHDGAPFLLEMNTSPGMTGHSLVPMAA
RAVGISYEDFVLQLAATASLELRASHDWKPE

BLAST