GenomeNet

>rso:RSc3309 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) gstM; probable glutathione s-transferase protein (A)
MKLYYAPGACSLAVHIALREVGVPFDLAAVDLAQHTTADGGDFYAVAPRGYVPVLELADG
SRHTEGAALLQHVADLDPSQALIGAPGSPRRLAVVQWLTFVSTELHKVFSPWLWHKETAE
STRQWVKDKLAARFAELEALFARQPWLTGDYSVADAYAFTVINWANLLALPLTPYPNLKA
YLERVAARPKVQEALRAEGLAK

BLAST