GenomeNet

>rsp:RSP_1282 K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] | (RefSeq) cbbL; ribulose 1,5-bisphosphate carboxylase large subunit (A)
MDTKTTEIKGKERYKAGVLKYAQMGYWDGDYVPKDTDVLALFRITPQEGVDPVEAAAAVA
GESSTATWTVVWTDRLTACDSYRAKAYRVEPVPGTPGQYFCYVAYDLILFEEGSIANLTA
SIIGNVFSFKPLKAARLEDMRFPVAYVKTYKGPPTGIVGERERLDKFGKPLLGATTKPKL
GLSGKNYGRVVYEGLKGGLDFMKDDENINSQPFMHWRDRFLYVMEAVNLASAQTGEVKGH
YLNITAGTMEEMYRRAEFAKSLGSVIVMVDLIIGYTAIQSISEWCRQNDMILHMHRAGHG
TYTRQKNHGISFRVIAKWLRLAGVDHLHCGTAVGKLEGDPLTVQGYYNVCREPFNTVDLP
RGIFFEQDWADLRKVMPVASGGIHAGQMHQLLSLFGDDVVLQFGGGTIGHPMGIQAGATA
NRVALEAMVLARNEGRNIDVEGPEILRAAAKWCKPLEAALDTWGNITFNYTSTDTSDFVP
TASVAM

BLAST