GenomeNet

>rta:Rta_07380 Glutathione S-transferase (Glutathione transferase)-like protein; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MLKLYIGNKNYSSWSMRPWVLLRQAGIPFEEVKVRFDRDADSAFQKTVAAVSPAGLVPVL
VDGDLAVWDTLAIAEYLAERFPERALWPRDTRARARARSVCAEMHAGFSALRSHCPMNIE
ATLPQVGALVWRDQPAVRADVQRIVDMWTGLLEQHGGPMLFGEFSIADAFFAPVCMRLKT
YALPVPAPVTDYIRRVGALPGVKAWVDDALAEKDFLDFEEPYRTAR

BLAST