GenomeNet

>rta:Rta_07380 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) Glutathione S-transferase (Glutathione transferase)-like protein (A)
MLKLYIGNKNYSSWSMRPWVLLRQAGIPFEEVKVRFDRDADSAFQKTVAAVSPAGLVPVL
VDGDLAVWDTLAIAEYLAERFPERALWPRDTRARARARSVCAEMHAGFSALRSHCPMNIE
ATLPQVGALVWRDQPAVRADVQRIVDMWTGLLEQHGGPMLFGEFSIADAFFAPVCMRLKT
YALPVPAPVTDYIRRVGALPGVKAWVDDALAEKDFLDFEEPYRTAR

BLAST