GenomeNet

>rtr:RTCIAT899_PC09420 DNA ligase D; K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] (A)
MALETYNRKRDFSRTTEPRGRAGKKKIAISGNSYVIQKHDARRLHYDFRLELDGVLKSWA
VTKGPSLIVGEKRLAVQTEDHPLEYGDFEGTIPKGEYGGGTVIVWDKGSWTPLGDPHKGL
AKGHLEFELHGKKLGGRWHLIRMAGKPREKRENWLLIKGEDEAARPEGAADILEERPESA
KTGRIIDEVENEKPGWSSKSGKIRRRTSRKKDDDAKEEADKAETQTDATPVDPSSLKGAL
KAPLPSFVEPALATLVSKPPSGSRWLHEIKFDGYRLEVRIEAGRIKLLTRSGLDWSQKFG
KEIVSAFRDLPVGTAIIDGELVVEPAAGASDFSALQADLSEGRSDRFVFYAFDLLYLDGY
DLKASPLIGRKELLRKIIPSETGILRFSSHFDENGDLLLSHACRLSLEGIVSKIANDPYR
PGRGKSWVKSKCSSRQEFVIGGWVPSTTSRKAIGSLVLGVYQDGKLEHVGRVGTGYTHTV
AEQLFKRLTRLQVKENPFATKLTAEEHRGVRFVQPELVAEVEFRAWTADGHLRHASFRGL
REDKNPLEIVRETPKSTRESSAEKPARSSVSLTHGDRLYWPDEGVTKAGLADYYAEVWRY
MGPFVVGRPLALVRCPNGIAGQHFFQKHAWKGMNRNIALAKDPQDEEPYVSIDDLNGLIG
LVQAAVLEIHPWGSMIGNWEKPDMIIMDLDPGPDVAWSKVIAAAEETAERLRQTGLVPFV
KTSGGKGLHIVCPLVARAEWPAVKAFTKGIADAMAADSPDRYVSTITKSKRRGKILIDYL
RNQRGSTAVAPYSTRARPGAAVSMPLLWEELSPAIGPDYFTVLNVPTRLAALHSDPWADF
RKAAEPLPQPAAKAKRKL

BLAST