GenomeNet

>sac:SACOL1434 K01775 alanine racemase [EC:5.1.1.1] | (GenBank) alanine racemase family protein (A)
MTATWSVNKKIFLQNAITVKNNQPLMAVVKNNAYHYDLEFAVTQFIHAGIDTFSTTSLRE
AIQIRQLAPDATIFLMNAVYEFDLVREHQIHMTLPSLTYYYNHKNDLAGIHVHLEFENLL
HRSGFKDLNEIKEVLKDHHHNQNAKMIISGLWTHFGYADEFDVSDYNVERSQWMEIVEAL
LSEGYQFDLIHAQNSASFYREGQILLPHHTHARVGIALYGSRPYSSLNQHDIVQSLTLKA
HVIQVREVQAGDYCGYSFAFEVTKNNTKLAVVDIGYGDGILRTRAKHEALINGKRYPIRA
LMMSHMFVEVDGNVHAQDEVILYNNDIRIDEYTFKGVGANSEQLSAMNHDSLKKEYISND
C

BLAST