GenomeNet

>saci:Sinac_3390 ATP dependent DNA ligase-like protein; K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MPDLGDGESVEMKGSGAKPYVLKNVGGVYSCSCPAWRNQSTAIERRTCKHLRKLRGEAAE
QARVGLDPVPAPENEGEANGESAEAKSGPPLLLAEKWDNAEDLAGWWLSEKLDGVRAYWN
GQALISRLGNRFHAPPWFLEGLPETPLDGELWIGRKAFQRTVGIVRRQDQSDLWKEVTYV
VFDAPGVDAAFEDRLAFVSAHKAQCRSPYLKAHEHTPCTGLVQLREELARVEALGGEGLM
LRQPGSRYEVGRSTTLLKVKSFRDAEARVLEHLKGAGRHKGRLGALLVELADGTRFSVGT
GFSDAERSAPPAIGSTITFRYQELSDSGVPRFPSYVRVRSDLAGLEP

BLAST