GenomeNet

>saci:Sinac_6085 hypothetical protein (A)
MGRFVILEHRWNGVHWDLMLERDGVLRTWAVAEAIVAGRNLPARALADHRLHYLDYEGAI
SGGRGAVRRIDSGTYQSSLWTSETVRFQLEGAQVAGAAVLFRIESGLADEPFSWFFRLGN
LD

BLAST