GenomeNet

>saci:Sinac_6085 no KO assigned | (GenBank) hypothetical protein (A)
MGRFVILEHRWNGVHWDLMLERDGVLRTWAVAEAIVAGRNLPARALADHRLHYLDYEGAI
SGGRGAVRRIDSGTYQSSLWTSETVRFQLEGAQVAGAAVLFRIESGLADEPFSWFFRLGN
LD

BLAST