GenomeNet

>sad:SAAV_1382 alanine racemase family protein; K01775 alanine racemase [EC:5.1.1.1] (A)
MTATWSVNKKIFLQNAITVKNNQPLMAVVKNNAYHYDLEFAVTQFIHAGIDTFSTTSLRE
AIQIRQLAPDATIFLMNAVYEFDLVREHQIHMTLPSLTYYYNHKNDLAGIHVHLEFENLL
HRSGFKDLNEIKEVLKDHHHNQNAKMIISGLWTHFGYADEFDVSDYNVERSQWMEIVEAL
LSEGYQFDLIHAQNSASFYREGQILLPHHTHARVGIALYGSRPYSSLNQHDIVQSLTVKA
HVIQVREVQAGDYCGYSFAFEVTKNNTKLAVVDIGYGDGILRTRAKHEALINGKRYPIRA
LMMSHMFVEVDGNVHAQDEVILYNNDIRIDEYTFKGVGANSEQLSAMNHDSLKKEYISND
C

BLAST