GenomeNet

>saga:M5M_17395 dipeptidyl carboxydipeptidase family protein; K01283 peptidyl-dipeptidase A [EC:3.4.15.1] (A)
MRTPHKLSVLALAVATGLLVGCQPEGKEKATVAQAEAAKVYDQAAADAFLEEAEAALKDT
AEYASRASWLAATYINGDSQFVEARASKEYTLQVVKYAMQVKNWDGAQVDPVTRRKLDAL
RLGLSFPSPADEKLAGELADIGSKMQGMYGAGKYCRESGECLDLIQMSNILAEGKDPALM
MEVWTGWRSVSPPMRPLYQRQVEIANAGAQDLGFENLSVLWRSNYDMAPDAFAADVDKQW
GKVKPLYDALHCHVRAKLNEAYGDDVVPATGKIPAHMLGNMWAQTWGNVYDKVKPANSQK
SYDLTKLIEKSGMNEIGMVRTAEAFFSSLGFAPLPDSFWETSQFVKPRDRDVVCHASAWN
MDSKDDLRIKMCIQKNGEDFQTVHHELGHNYYQRAYNQQPFLFQGSANDGFHEALGDTVA
LSITPSYLVSLGMLKEEPPVSEDLGYLMQMALDKIAFLPFGLLVDKWRWQVFNGEIKPED
YNKGWWSLREQYQGITPPVARSEADFDPGAKYHIPGNTPYTRYFLAFIQQFQFHRSLCET
AGYEGPLHRCSIYNNKAAGDKLQAMMAMGTSQPWQNAMQALTGQPELDASAIVDYFAPLK
VWLDEQNKDRQCGW

BLAST