GenomeNet

>sak:SAK_1891 K01186 sialidase-1 [EC:3.2.1.18] | (GenBank) sialidase domain protein (A)
MVIVLGDSDSQEKLSSPLKAEIATEENRKQANLAELNVTQADNRTTYIIPESSHSIAEQQ
RFLIESKGSSVALLNSAEFRKTAGEDRGFERDKLRSLDIIPKGDLSTSNVIGNTDIASQI
SLGFKKNAIQEHHLTKTFSQKDGKLSSVIEGMLAIGKEKVEKEIKYSGNLWQKLKAKAHC
LVCCVDNLNFEDIKSYFQYYCHLNHQLKLPKGAILSAKTEVYRGGDFGRKNKDNVFGYRI
PSLLKTEKGTLLAGADERIEQACDWGNIGMVIRRSEDDGVTWGKRETIVNLRNNPRVPLV
TSGDYSGSPINMDMALVQDTSSKTKRIFSIYDMFPEGRGVISIANTPEKEYTQIGGQSYL
NLYNNGKKSKVFTIRDKGIVYNFKGKKTDYHVITETTKSDHSNLGDIYKGKQLLGNIYFT
KHKTSPFRLAKSSYVWMSYSDDDGRTWSSPRDITASLRQRGMKFLGIGPGKGIVLKWGPH
AGRIIIPAYSTNWKSHLRGSQSSRLIYSDDHGKTWHTGKAVNDNRILSNGEKIHSLTMDN
KKEQNTESVPVQLKNGDIKLFMRNLTGNLEVATSKDGGETWQNHVKRYKEIHDAYVQLSA
IRFEHDKKEYILLVNANGPGKKRQDGYARLAQVNRNGSFKWLYHHHIQDGSFAYNSVQQL
NNDQFGVLYEHREKHQNSFTLNYKVFNWSFLSQNTEKQGTLWEKMAANWHVLFKFYL

BLAST