GenomeNet

>saq:Sare_1486 no KO assigned | (GenBank) DNA polymerase LigD polymerase domain (A)
MGGAKAVAEEIEVAGRHVRLSSPDRVMFPQRGFTKADVFHYYLAVGPGIMRALGQRPTTL
QRFPEGIEGEAFFQKRVPARGMPSWVHTAKISFPSGRTAAELCPADLAHVAWAAQMGTVV
FHPWPVRAADPDRPDELRIDLDPQPGTDFADAARAASELHGILTELGAPGWPKTSGGRGV
HVYLRIRPHWTFVEVRRATIALARELERRRPELVTTAWWKEERGARVFVDYNQMARDRTI
ACAYSLRANARATVSTPLAWDELADVDPDDFDLRSVPARLAERGDPHADIDDAAWDITPL
LEWAERDAANGQGDLPYPPEHPKMPGEPKRVQPSKDRDRPR

BLAST