GenomeNet

>saq:Sare_1486 DNA polymerase LigD polymerase domain (A)
MGGAKAVAEEIEVAGRHVRLSSPDRVMFPQRGFTKADVFHYYLAVGPGIMRALGQRPTTL
QRFPEGIEGEAFFQKRVPARGMPSWVHTAKISFPSGRTAAELCPADLAHVAWAAQMGTVV
FHPWPVRAADPDRPDELRIDLDPQPGTDFADAARAASELHGILTELGAPGWPKTSGGRGV
HVYLRIRPHWTFVEVRRATIALARELERRRPELVTTAWWKEERGARVFVDYNQMARDRTI
ACAYSLRANARATVSTPLAWDELADVDPDDFDLRSVPARLAERGDPHADIDDAAWDITPL
LEWAERDAANGQGDLPYPPEHPKMPGEPKRVQPSKDRDRPR

BLAST