GenomeNet

>say:TPY_0781 rbcS; ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit; K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] (A)
MPFHLTQGTFSFLPPLNDDQIRAQIQYAINNGWAINIEFTDDPHPRNFLWDMWGLPMFDL
QDPAAVMYELNQCKEAYPHHYIRINAYDSSLGRQTTALSFIVNRPPSDPGMNVIRQEGPD
RQIRYTIHSYATDNPPGSRL

BLAST