GenomeNet

>say:TPY_0781 K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] | (GenBank) rbcS; ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit (A)
MPFHLTQGTFSFLPPLNDDQIRAQIQYAINNGWAINIEFTDDPHPRNFLWDMWGLPMFDL
QDPAAVMYELNQCKEAYPHHYIRINAYDSSLGRQTTALSFIVNRPPSDPGMNVIRQEGPD
RQIRYTIHSYATDNPPGSRL

BLAST