GenomeNet

>say:TPY_1568 hypothetical protein; K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] (A)
MRRWPHGILGPTFYQKHQPEGGPIRVHTVHELLRWVGQGVIEWHAPLGSTYRQHEWAVLD
LDPEPQASWHDVVAVATMVTTLLREVGWSYVMKTSGQDGLHIFCPIEPAEPPVVTAVMKY
FAELMAAAAPDLVTVERLKSKRQGRVYVDYLQNGAHRTMVMAYSVRATPDARISWPLMPD
QLSLGPARWTVGWVLDQPPTSWPPFDGSVLPPAALQDTVRRFGIRAETSTAAWKW

BLAST