GenomeNet

>say:TPY_2958 K00113 glycerol-3-phosphate dehydrogenase subunit C [EC:1.1.5.3] | (GenBank) protein of unknown function DUF224 cysteine-rich region domain protein (A)
MWPHLAYDACLKCQICLSACPVYWVEDDFPGPKAAGPDWYRRAEAGDDTPLPHVDDCTFC
QLCEEACPADVPIAHLIAEHKARLSKSGRMRMRDFILKRPHWVARYPRLGHIRGAVAEWM
GLSRQSRRPRIYRQRTATRSTVRPPVQGRVGLFIDCFNRGYDEVVIARAEALLNLWGYEV
IRLPAEFRCCGAAAYAGGDSALARRLGHETALAIESVVRREKPSVLVTLNATCDGTLRDE
WPTYYGLSISLPVIPFEEFAWEKAPQEFWAVLRRAAPETSLTHTTCRGQVARGNGLLSAL
AKRAGWEAVHLPISCCGAAGSYAFKAEHDATAHRLAEAALPAVSRDPSFLMVDSGTCAVH
LQQVLGIVARHPAYWLYERYQEGMKENDGTPKALNADHHSGAPSA

BLAST