GenomeNet

>sbh:SBI_08909 no KO assigned | (GenBank) hypothetical protein (A)
MAETAELTVGERTVRLTNPGKVYFPQRGFTKLDVARYYLAVGEGVLRALRDRPTMLERYP
DGVEGESFFQKRAPKNLPEWIPTGRISFPSGRHADEICPTEPAAVVWAANLGCLTFHPWP
VRRQDTDHPDELRIDLDPQPGTDYEDAVWAAGQLRPVLEELGLRGWPKTSGGRGLHVFVP
IEPVWTFTQVRRAAIAIARELERRAPRRITTAWWKEERGEKVFVDYNQTARDRTIASAYS
VRPRPHAPVSAPLHWEEVPDARPRDFDLATMPVRFRELGDVHADMDEQVCRLEAALELAD
RDERDHGLGDLPYPPEHPKMKGEPKRVQPSRAKK

BLAST