GenomeNet

>sbi:SORBI_01g018700 SORBIDRAFT_01g018700, Sb01g018700; hypothetical protein; K10747 DNA ligase 1 [EC:6.5.1.1] (A)
MFLLRATSSSTTTATSSLLLRCRPLPSPKTLALAPPPTILPFCFRSRLSASASSASRRRR
ATAAAAAGKSGEKKPPTARAKQADAGPAAAAAAGMSASGGGSSGKRTVADVLMGNARAAA
SKAKKAAPSPKKPRAKADGAEAELEAAAVAEKPPSPVRSKRASSPAKSPKLLADGSTSPA
KSKGPAAAAQLDAAKENSPSPKRSKTLAAKSDTQPSGEGVVSHTDGKKGSPAPTKAKGQA
SQQEEKKRATSPKKAKTTDSDSAKTEEKNTTRATSPKKAKTTDSRKAEEKNTTLELKKKG
SEFDPMAAAYWKPGEPVPFLFLARALDLISNESGRIVITEILSNVFRTVMATTPDDLLAT
VYLSANRIAPPHEGIELGIGDASVIRALAEAYGRKEEHVKKDLKELGDLGLVAKASRSSQ
KMMFKPKPLTIARVLSTFRAIAKESGKDSQDKKRNHMKGLLVAATDCEPQYITRLLQSKM
RIGLAEKTVQMALGQAAVYSDKNSSPPKVQSPFEEAAKIIKQAYSVLPIYDKIVPAILEV
GVWKLPETCKFSIGVPVGPMLAKATKSVSEIIDKFQGLEYTCEYKYDGERAQIHCMEDGS
VEIYSRNAERNTGKYPDVVDAVSRFRKPTVKSFVLDCEIVAYDREKQKILPFQILSTRAR
KGVTINDIKVSVCTFGFDILYINGKPLLQEQLKIRREHLYNSFEEVPGVFQLATAITSND
LEEIQKFLDTAVNSSCEGLIIKTLDKDATYEPAKRSNNWLKLKKDYMDSIGDSLDLVPIA
AFYGRGKRTGVFGSFLLACYDEQNEEYQTICNIGTGFSEQQLEERSASLRSKVIEKPKAY
YRFADTMDPDVWFEPSEVWEVKAADLSISPVHRAANGIVDPNKVADMYRSQKINHGYNQE
DEDDD

BLAST