GenomeNet

>sbi:SORBI_01g030950 K00799 glutathione S-transferase [EC:2.5.1.18] | (RefSeq) SORBIDRAFT_01g030950, Sb01g030950; hypothetical protein (A)
MAGGGDELKLLGMWASPFVLRVKLALSFKGLSYEYVEEDLRNKSDLLLSSNPVHKKVPVL
IHNGKPVCESQIIVQYLDEVYSAAGPSFLPVDPYERAMARFWASFIDEKFLASWIKAGRG
KTDEEKAEGLKLTFAAIETLEGAFKECSKGKPFFGGDSVGYLDIALGALVAWMHTAEVRH
GLRLFDASRSPLLEKWVERFGKLDEVVAVLPDIDRLVEHAKVREAEVAAAAAGN

BLAST