GenomeNet

>sbi:SORBI_01g030970 SORBIDRAFT_01g030970, Sb01g030970; hypothetical protein; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MAGAGEGGDELKLLGNLTSPFVLRVKLALSFKGLSYEYIAEDLQNKSNLLLSSNPVHKKV
PVLIHKGEPICESQVIVQYIDEAFQGTDGPSLLPADPYERAVARFWAAYVFDKLLPAWLQ
SFMGKTDEEKAEGLKQTFAAVDQLEAAFKECSKGKPFFGGDSVGHMDVALGSLVPWGVYA
GEKLYGFRLFDAARSPLLNAWLERFAALDAAKAVLPDADRLVDYAKMKRAEAEAAAAAAA
SSNN

BLAST