GenomeNet

>sbi:SORBI_01g041700 SORBIDRAFT_01g041700, Sb01g041700; hypothetical protein; K01580 glutamate decarboxylase [EC:4.1.1.15] (A)
MVLSKAVSESDMSVHSTFASRYVRSSLPRYRMPENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMAAINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGESETAVG
VGTVGSSEAIMLAGLAFKRRWQNKRRAEGKPFDKPNIVTGANVQVCWEKFARYFEVELRE
VKLRDGYYVMDPEKAVEMVDENTICVAAILGSTLNGEFEDVKLLNDLLEVKNGETGWGTP
IHVDAASGGFIAPFLYPELEWDFRLPWVKSINVSGHKYGLVYAGIGWCIWRSKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRHGFEGYRNIMENCHENAMVLKEGLEK
TGRFNIVSKDEGVPLVAFSLKDRSRHDEFEISDMLRRFGWIVPAYTMPADAQHVTVLRVV
IREEFSRTLAERLVLDIEKVMYQLDALPSRIPPPPPPAQLVRKKSELETQRSVTEAWKKF
VLAKKTNGVC

BLAST