GenomeNet

>sbi:SORBI_01g041700 K01580 glutamate decarboxylase [EC:4.1.1.15] | (RefSeq) SORBIDRAFT_01g041700, Sb01g041700; hypothetical protein (A)
MVLSKAVSESDMSVHSTFASRYVRSSLPRYRMPENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMAAINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGESETAVG
VGTVGSSEAIMLAGLAFKRRWQNKRRAEGKPFDKPNIVTGANVQVCWEKFARYFEVELRE
VKLRDGYYVMDPEKAVEMVDENTICVAAILGSTLNGEFEDVKLLNDLLEVKNGETGWGTP
IHVDAASGGFIAPFLYPELEWDFRLPWVKSINVSGHKYGLVYAGIGWCIWRSKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRHGFEGYRNIMENCHENAMVLKEGLEK
TGRFNIVSKDEGVPLVAFSLKDRSRHDEFEISDMLRRFGWIVPAYTMPADAQHVTVLRVV
IREEFSRTLAERLVLDIEKVMYQLDALPSRIPPPPPPAQLVRKKSELETQRSVTEAWKKF
VLAKKTNGVC

BLAST