GenomeNet

>sbi:SORBI_01g047500 SORBIDRAFT_01g047500, Sb01g047500; hypothetical protein; K01177 beta-amylase [EC:3.2.1.2] (A)
MMALNLAHQTGAAVTAAPTAPRSAVVAAAATVSAPSASASAAPAPALQMQTMTVDAAPAQ
APDAVKPDLAMACQALVEGSTPDEAQHADVAAELKTKAGVPVFVMMPLDTVRKDGNSLNR
RKAVEASLAALKSAGVEGIMVDVWWGIAEADGPGQYNFNGYMELMEMARKTGLKVQAVMS
FHQCGGNVGDSVTIPLPRWVVEEMDKDQDLAYTDRSGRRNYEYVSLGCDTLPVLKGRTPI
QCYADFMRAFRDHFATFMGNTIVEIQVGMGPAGELRYPSYPESDGTWSFPGIGEFQCYDR
YMLSSLKAAAESVGKPEWGNGGPGDAGGYKNWPEDTGFFRREGGWSNEYGQFFMSWYSQM
LLEHGERILSAATGVYTGSPGVKISVKVAGIHWHYGTRSHAAELTAGYYNTRHHDGYAPI
ARMLARHGAVLNFTCVEMRDHEQPQDAQCRPEALVQQVAAAAREAGVGLAGENALPRYDE
TAHDQVVATAADRAAEDRMVAFTYLRMGPDLFQPDNWRRFAAFVKRMSQPGARDACREQV
EREADGVAHATQPLVHEAAVALTN

BLAST