GenomeNet

>sbi:SORBI_02g012320 K01177 beta-amylase [EC:3.2.1.2] | (RefSeq) SORBIDRAFT_02g012320, Sb02g012320; hypothetical protein (A)
MDPAAEDGPVAKQVPDVAPRPPERDFAGTPYVPVYVMLPLGVVNGNGEVVDADELVGQLR
VLKAAGVDGVMVDCWWGNVEAHRPQEYNWTGYRRLFQMIRELKLKLQVVMSFHECGGNVG
DDISIPLPHWVIEIGRSNPDIYFTDRAGRRNTECLSWGIDKERVLQGRTAVEVYFDFMRS
FRVEFDEYFEDGIISEIEIGLGACGELRYPSYPAKHGWKYPGIGEFQCYDRYLQKSLRKA
AEARGHTIWARGPDNAGHYNSEPNLTGFFCDGGDYDSYYGRFFLSWYSQTLVDHADRVLM
LARLAFEGSNIAVKVSGVHWWYKTASHAAELTAGFYNPCNRDGYAPIAAVLKKYDAALNF
TCVELRTMDQHEVYPEAFADPEGLVWQVLNAAWDAGIQVASENALPCYDRDGFNKILENA
KPLNDPDGRHLFGFTYLRLSNVLFERPNFFEFERFVKRMHGEAVLDLQV

BLAST