GenomeNet

>sbi:SORBI_03g003190 K00844 hexokinase [EC:2.7.1.1] | (RefSeq) SORBIDRAFT_03g003190, Sb03g003190; hypothetical protein (A)
MATAALAMAEQVVADLRAKCEAPPPMLREVAAEMAREMGAGLEKEGGSRVKMLLSYVDKL
PTGGEEGLFYGLDLGGTNFRVLKVELGGNEKHVVDRDSREVIIPPHLMSGSSSELFGFIA
SELAKFVVDDEKFINVLNGKKRELGFTFSFPVKQRSVASGTLVKWTKAFSINDAVGEDVV
AKLQTAMEKQGLDMHVAALINDAVGTLAGARYYDKDVVAGVIFGTGTNAAYVEKANAIPK
WEGELPNSGDMVINMEWGNFCSAYLPITEYDQELDKESLNPGEQIYEKLTSGMYLGEIVR
RVLLKISLQSAIFGNIDHTKLETPFLLRTPHISAMHHDETPDLKIVAKKLEENLEITGAS
LEARKLVVEICDIVATRAARLAAAGLAGILMKLGRDCSVEDQRSVIAIDGGLFEHYTKFR
QCLETTLGELLGDEASKAVAVKHADDGSGIGAALIAASQSLYKNDLVAVKHADDKHADDK
HEDADDKHEDDGKGVKHADDGSEIGAALIAASQSQ

BLAST