GenomeNet

>sbi:SORBI_03g003190 SORBIDRAFT_03g003190, Sb03g003190; hypothetical protein; K00844 hexokinase [EC:2.7.1.1] (A)
MATAALAMAEQVVADLRAKCEAPPPMLREVAAEMAREMGAGLEKEGGSRVKMLLSYVDKL
PTGGEEGLFYGLDLGGTNFRVLKVELGGNEKHVVDRDSREVIIPPHLMSGSSSELFGFIA
SELAKFVVDDEKFINVLNGKKRELGFTFSFPVKQRSVASGTLVKWTKAFSINDAVGEDVV
AKLQTAMEKQGLDMHVAALINDAVGTLAGARYYDKDVVAGVIFGTGTNAAYVEKANAIPK
WEGELPNSGDMVINMEWGNFCSAYLPITEYDQELDKESLNPGEQIYEKLTSGMYLGEIVR
RVLLKISLQSAIFGNIDHTKLETPFLLRTPHISAMHHDETPDLKIVAKKLEENLEITGAS
LEARKLVVEICDIVATRAARLAAAGLAGILMKLGRDCSVEDQRSVIAIDGGLFEHYTKFR
QCLETTLGELLGDEASKAVAVKHADDGSGIGAALIAASQSLYKNDLVAVKHADDKHADDK
HEDADDKHEDDGKGVKHADDGSEIGAALIAASQSQ

BLAST