GenomeNet

>sbi:SORBI_03g008410 SORBIDRAFT_03g008410, Sb03g008410; hypothetical protein; K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] (A)
MLDTTDDIAEGISFQAFEDDCRLLASLLHDVLLRELGPRFIQILERNRILAQSAVSMRAA
GMEDTAAVVERQLEADLAAMSLDDALCVARAFSHYLNLMGIAETHHRVRKARNIEQLSKS
CDDIFNKLIQSGVPPEQLYDTVCKQEVEIVLTAHPTQINRRTLQYKHLRVAHLLEFNGRP
DLSHEDKEMLIEDLVREITAIWQTDELRRHKPTPVDEARAGLHIVEQSLWKAIPHYLRRV
SSALKKHTGRPLPLTCTPIKFGSWMGGDRDGNPNVTAKVTRDVSLLSRWMAIDFYIRELD
NLSFELSIKRCSDKVASLANDIILKESASEDLKANTWNKTVPQNNAKLHHNLALPAQLPS
GADLPSCTECSDGESQFRMINLPRNSSRPGALNLTEKIEDSPLSSPTSRQPQLSRTSSGH
QLRKLFKESHIGRSSSFQKLLEPSLSDRPGITPYRVVLGNVKEKLVKTRRRLELLLEDLP
CDYDTEEYCETSDQLLEPLLLCHQSLQSCGASVLADGRLADLIRRVATFGMVLMKLDVRQ
ESGRHTEALDSVTSYLDLGVYSEWDEEKKLDFLTRELKGKRPLVPQNIEVSADVKEVLDT
FKVAAELGSDSLGAYVISMASNASDVLAVELLQKDARLTVSGDLGRPCPGGTLRVVPLFE
TVKDLQAAGSAIRKLLSIDWYREHIIKNHNGHQEVMVGYSDSGKDAGRFTAAWELYKAQE
DVVAACNEFGIKVTLFHGRGGSIGRGGGPTYLAIQSQPPGSVMGTLRSTEQGEMVQAKFG
LPQTAVRQLEIYTTAVLLATLRPPHPPRDPNWRTVMEEISRASCAHYRATVYEDPEFITY
FQEATPQAELGHLNIGSRPAKRKQALGGISSLRAIPWVFAWTQTRLVLPAWLGVGTGLQD
ALDRGHGAELRAMYGEWPFFQSTVDLIEMVTAKADAPVAAHYEEMLVAPERRAVGERLRK
ELARTERCVLAVSGHSKLTAHNRSLRRLIESRLAYLNPINMLQVEVLRRLRRDDDNRRLR
DALLITINGIAAGMRNTG

BLAST