GenomeNet

>sbi:SORBI_03g034060 SORBIDRAFT_03g034060, Sb03g034060; hypothetical protein; K00850 6-phosphofructokinase 1 [EC:2.7.1.11] (A)
MASSHIILPKEEEEEEKEAAAVAEAGLGVGVEADHDSPAQRPYQEQAPGKAALPFSATCV
RISRDSYPNLRALRNASTMALHDDDAAFVKIEEGDFGYVLDDVPHLTDYLPDLPTFPNPL
QDHPAYSTVKQYFVNADDTVPEKVVVQKNSPRGVHFRRAGPRQRVYFESEEVKACIVTCG
GLCPGLNTVIRELVCGLSHMYNVSNVFGIQNGYKGFYSSNYLPMTPKSVNDIHKRGGTVL
GTSRGGHDTKKIVDNIQDRGINQVYIIGGDGTQKGAYEIYKEIRRRGLHVAVAGIPKTID
NDIAVIDKSFGFDTAVEEAQRAINAAHVEASSAENGIGLVKLMGRYSGFIAMYATLASRD
VDCCLIPESPFYLEGEGGLFEYIDRRLKENNHMVIVVAEGAGQDLIAQSIPAADQQDASG
NKLLLDVGLWLTHKIKDYCKSKKMEMTIKYIDPTYMIRAIPSNASDNVYCTLLAHSAIHG
AMAGYSFTVGMVNGRHAYIPFHRVTSTRNKVRITDRMWARLLSSTNQPSFLSQKDIDAAR
EADKAANAKNQSAPALANGEK

BLAST