GenomeNet

>sbi:SORBI_03g034060 K00850 6-phosphofructokinase 1 [EC:2.7.1.11] | (RefSeq) SORBIDRAFT_03g034060, Sb03g034060; hypothetical protein (A)
MASSHIILPKEEEEEEKEAAAVAEAGLGVGVEADHDSPAQRPYQEQAPGKAALPFSATCV
RISRDSYPNLRALRNASTMALHDDDAAFVKIEEGDFGYVLDDVPHLTDYLPDLPTFPNPL
QDHPAYSTVKQYFVNADDTVPEKVVVQKNSPRGVHFRRAGPRQRVYFESEEVKACIVTCG
GLCPGLNTVIRELVCGLSHMYNVSNVFGIQNGYKGFYSSNYLPMTPKSVNDIHKRGGTVL
GTSRGGHDTKKIVDNIQDRGINQVYIIGGDGTQKGAYEIYKEIRRRGLHVAVAGIPKTID
NDIAVIDKSFGFDTAVEEAQRAINAAHVEASSAENGIGLVKLMGRYSGFIAMYATLASRD
VDCCLIPESPFYLEGEGGLFEYIDRRLKENNHMVIVVAEGAGQDLIAQSIPAADQQDASG
NKLLLDVGLWLTHKIKDYCKSKKMEMTIKYIDPTYMIRAIPSNASDNVYCTLLAHSAIHG
AMAGYSFTVGMVNGRHAYIPFHRVTSTRNKVRITDRMWARLLSSTNQPSFLSQKDIDAAR
EADKAANAKNQSAPALANGEK

BLAST