GenomeNet

>sbi:SORBI_03g034230 SORBIDRAFT_03g034230, Sb03g034230; hypothetical protein; K00844 hexokinase [EC:2.7.1.1] (A)
MGKGAVVGTAVVVGAAAAAAVGVAVVSLSRRRRRRREAEDERKRKAAAVIEEVEQRFSTP
TALLRGIADAMVEEMERGLRAEPHAPLKMLISYVDNLPTGDEQGLFYALDLGGTNFRVIR
VQLGGRDKRVVKQQYEEVSIPPHLMVGTSTELFDFIAAELEKFVRTEGEDFHLPNGKQRE
LGFTFSFPVHQTSISSGTLIKWTKGFSINGTVGEDVVAELSRAMERQGLDMKVAALVNDT
VGTLAGGRYADNDVVTAVILGTGTNAAYVEHANAIPKWTGLLPRSGNMVINMEWGNFRSD
KLPMSEYDKSLDFESLNPGEQIYEKMISGMYLGEIVRRILLKLAHDASLFGDVVPPKLEQ
LFILRTPDMSAMHHDTSHDLKHLGAKLKDILGVPDTSLEARYITLHVCDLVAERGARLAA
AGIYGILKKLGKDKLLSDFSQQRTVVAIDGGLYEHYKKFSACLEATLTDLLGEEVASSVV
VKLANDGSGIGAALLAASHSQYAEVA

BLAST