GenomeNet

>sbi:SORBI_03g035090 K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] | (RefSeq) SORBIDRAFT_03g035090, Sb03g035090; hypothetical protein (A)
MARNAVDKATSIDAQLRLLAPQKLSDDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC
YELAAEYENKLDPKMLDEIGNVLTDWDRGDSMVITKSFSHRLILANLAEEVQMAYRRRIK
LKKGDFVDENSATTESDIEETLKRLMHQLKKSPLEVLDALKNQTVDLVLTAHPTQSVRRS
LLQKHGRIRNCLTQLYAKDITPDEKQELDEALQREIQAAFRTDEIRRAPPTPQDEMRAGM
SYFHETIWKGVPKFLRRVDTALKNIGINERLPYNAPIIQFSSWMGGDRDGNPRVTPEVTR
DVCLLARMMAANLYNAQIEDLMFELSMWRCSDELRVKVDELQCSSKKDRTKHYIEFWKQV
PPSEPYRVILSDVRDKLYNTRERARHLLASGFSEIPEEATFTDVEQFLEPLELCYRSLCA
CGDQSIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVMDAITEYLGIGSYRKWTEEK
RQEWLLSELNGKRPLFGPDLPKSDEIADVLDTFHVLAELPSDSFGAYVISMATAPSDVLA
VELLQRECHVKKPLRVVPLFEKLADLEAAPAALARLFSVEWYRNRINGKQEVMIGYSDSG
KDAGRFSAAWQLYKAQEELINVAKMYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPETIH
GSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPISPKPEWRALMDEMAIVAT
KEYRSIVFEEPRFVEYFRLATPEMEYGRMNIGSRPSKRKPSAGIESLRAIPWIFAWTQTR
FHLPVWLGFGAAFKHVLDKDIRNLQTLQEMYNQWPFFRVTIDLVEMVFAKGDPGIAALYD
KLLVSEDLWSFGKRLRANYEETKQLLLQVAGHKDLLEGDPYLKQRLRIRDSYITALNVCQ
AYTLKRIRDPGFQVNPGPHLSKDVMDIGKPASELVKLNTTSEYAPGLEDTLILTMKGIAA
GMQNTG

BLAST