GenomeNet

>sbi:SORBI_03g045850 SORBIDRAFT_03g045850, Sb03g045850; hypothetical protein; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MSGSAAVKVIGFFDSPFSHRAEAALCLKGVPYELIQEKDLRNKSELLLHHNPVHKKVPVL
LHGDRRAVCESLVIVEYVDEAFHGPPLLPADPADRAAARFWARFIEDKCSTSFWLAMWTE
GEVQQGFMREIKENLKLLEGQVKGKRFFGGDDVGYLDVAASGFAHWLPVCEEVAGVSVVT
AEEYPDLCRWAREYTSHDAVKQCLPDREELLARFSARKDSFVATARSMAPAPEKK

BLAST