GenomeNet

>sbi:SORBI_04g007470 K06067 histone deacetylase 1/2 [EC:3.5.1.98] | (RefSeq) SORBIDRAFT_04g007470, Sb04g007470; hypothetical protein (A)
MDPSSAGSGGNSLPSVGADGQKRRVCYFYDSDVGNYYYGQGHPMKPHRIRMTHSLLARYG
LLNQMQVYRPNPARDRDLCRFHADDYINFLRSVTPETQQDQIRLLKRFNVGEDCPVFDGL
YSFCQTYAGASVGGAVKLNHGHDIAINWSGGLHHAKKCEASGFCYVNDIVLAILELLKHH
ERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKFGDYFPGTGDIRDIGHSKGKYYSLNVP
LDDGIDDESYQSLFKPIMGKVMEVFRPGAVVLQCGADSLSGDRLGCFNLSIRGHAECVRY
MRSFNVPLLLLGGGGYTIRNVARCWCYETGVALGQELEDKMPVNEYYEYFGPDYTLHVAP
SNMENKNTRNQLDDIRSKLLDNLSKLRHAPSVQFQERVPDTEVPEPDEDQDDPDERHDPD
SDMEVDDHKAVEESARRSIPGIKVKREFGENETKVQDGGRIASDHRGVEPMAEDIGSSKQ
APQADASAMAVDEPSNVKNEPESSTKLQDQAAAYHKP

BLAST