GenomeNet

>sbi:SORBI_04g007470 SORBIDRAFT_04g007470, Sb04g007470; hypothetical protein; K06067 histone deacetylase 1/2 [EC:3.5.1.98] (A)
MDPSSAGSGGNSLPSVGADGQKRRVCYFYDSDVGNYYYGQGHPMKPHRIRMTHSLLARYG
LLNQMQVYRPNPARDRDLCRFHADDYINFLRSVTPETQQDQIRLLKRFNVGEDCPVFDGL
YSFCQTYAGASVGGAVKLNHGHDIAINWSGGLHHAKKCEASGFCYVNDIVLAILELLKHH
ERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKFGDYFPGTGDIRDIGHSKGKYYSLNVP
LDDGIDDESYQSLFKPIMGKVMEVFRPGAVVLQCGADSLSGDRLGCFNLSIRGHAECVRY
MRSFNVPLLLLGGGGYTIRNVARCWCYETGVALGQELEDKMPVNEYYEYFGPDYTLHVAP
SNMENKNTRNQLDDIRSKLLDNLSKLRHAPSVQFQERVPDTEVPEPDEDQDDPDERHDPD
SDMEVDDHKAVEESARRSIPGIKVKREFGENETKVQDGGRIASDHRGVEPMAEDIGSSKQ
APQADASAMAVDEPSNVKNEPESSTKLQDQAAAYHKP

BLAST