GenomeNet

>sbi:SORBI_04g024850 SORBIDRAFT_04g024850, Sb04g024850; hypothetical protein; K02358 elongation factor Tu (A)
MASLASASTSLLFPQATSSRSRVRLSTSLGFSAQPARLRSRAAAAGGQRRGRLLVVRAAR
GKFERTKPHVNIGTIGHVDHGKTTLTAALTMVLASVGGSAPKKYDEIDAAPEERARGITI
NTATVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSGADGPMPQTKEHILLA
KQVGVPKIVVFLNKKDMVDDEELLELVELEVRELLSNYEYDGDDVPIIAGSALKALEALM
ANPALKRGDNEWVDYIFNLVDEVDNYIPVPQRQTDLPFLLAVEDVFSITGRGTVATGRIE
RGTVKVGDTVDIVGIRDTRTCTVTGVEMFQKTMDDAMAGDNVGLLLRGMQKDDIERGMVL
AKPGSITPHTKFEAVVYVLKKEEGGRHSPFFPGYRPQFYMRTTDVTGSVTTIMNDKDEEA
KMCMPGDRIKMIVQLIQPVACEQGMRFAIREGGKTVGAGVINKIIE

BLAST