GenomeNet

>sbi:SORBI_04g024850 K02358 elongation factor Tu | (RefSeq) SORBIDRAFT_04g024850, Sb04g024850; hypothetical protein (A)
MASLASASTSLLFPQATSSRSRVRLSTSLGFSAQPARLRSRAAAAGGQRRGRLLVVRAAR
GKFERTKPHVNIGTIGHVDHGKTTLTAALTMVLASVGGSAPKKYDEIDAAPEERARGITI
NTATVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSGADGPMPQTKEHILLA
KQVGVPKIVVFLNKKDMVDDEELLELVELEVRELLSNYEYDGDDVPIIAGSALKALEALM
ANPALKRGDNEWVDYIFNLVDEVDNYIPVPQRQTDLPFLLAVEDVFSITGRGTVATGRIE
RGTVKVGDTVDIVGIRDTRTCTVTGVEMFQKTMDDAMAGDNVGLLLRGMQKDDIERGMVL
AKPGSITPHTKFEAVVYVLKKEEGGRHSPFFPGYRPQFYMRTTDVTGSVTTIMNDKDEEA
KMCMPGDRIKMIVQLIQPVACEQGMRFAIREGGKTVGAGVINKIIE

BLAST