GenomeNet

>sbi:SORBI_04g033260 K11420 euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43] | (RefSeq) SORBIDRAFT_04g033260, Sb04g033260; hypothetical protein (A)
MEGGGGGGGGAPVSPTAGGARRHKVLAPWRFQIGFVRREMNAGVVSDGKQGALETPQMSC
QTATSDVPSVSLNDGGGVDGESPAADGENEVPNNRGAGAVDGANRGLGGVDGNPAAKEGD
SLPKDGEFLVDLENDGVTADPHGMAKPSDLPGFQNNGPTEEINLAVNNSEGFVTSEGTVP
GCRKGRKTVVPWRFQIGHQPKWSQNLFSGNRSNGKAEDPTSKVGDRSRKDAPAMARNHSC
LKGSATSGQSSVRIPKGTGSAPKKRKVDKDDQYEATVNNRISVVRENVLTTLRAFRIIYE
KLLEEEQIKWRERGHGLSPDLAAFNIFRKRFCANYDDLKYDGSIPGVRIGDVFNSVMELY
IVGIHRAQSLPVDHIKKKDGTCLAVSVVSYAQPSVFDSLDFLLHVGSVTDTCDQEMEGTD
LALKESMDTDTPVRVIHAVVTDLGDDCQPKQLTSYVYGGLYLVEKFNREKTSGSQYVSIF
HLRRMTGQKHIDLQVLKTKMPESFAGTFIIDISGGLEKVPISAINSISNEYLTTFHYISQ
IQYPLKYRPDPPSGCDCVGGCSVSQKCACAVKNGGGFHFNDIGGLTEGKPLIYECGPSCK
CPPTCRNRVSQHGIKFRLQVFKTKSMGWGVRTLDFIPDGSFVCEYVGELLTDEEAQERKN
DEYLFAIGNSYYDAPHWEAEIKAIPSLQNGPIEDDETVFAVDALNQGNFARFINHCCTPN
LFPQNVLHDHDNISMPHIMFFASEDIPPLKELSYDYNYQIDKVYDSDGNIKMKYCFCGSN
ECNGRLY

BLAST