GenomeNet

>sbi:SORBI_04g034150 SORBIDRAFT_04g034150, Sb04g034150; hypothetical protein; K01176 alpha-amylase [EC:3.2.1.1] (A)
MASTSLCMCFFLVFLGLSFNLALGQVLFQGFNWESWKQNGGWYKFLMDKVDDIAEAGITH
VWLPPPSHSVAEQGYLPGRLYDLDASKYGNKAQLKSLIKAFHDKGVKVIADIVINHRTAE
HKDGRGIYCLFEGGTSDSRLDWGPHMICRDDKAYSDGTGNLDTGLDFPGAPDIDHLNKRV
QRELIGWLKWLQTDIGFDAWRLDFAKGYSAEVAKIFIDNAKPSFAVAELWSSLAYGGDGK
PLQDQNAHRQELVNWVDRVGGKASPATTFDFTTKGILNVAVDGELWRLRGADGKAPGMIG
WWPAKAVTFVDNHDTGSTQHMWPFPADKVIQGYAYILTHPGNPCIFYDHFFDSGLKNEIA
QLVSIRNRHGIQPDSKLRIIKADADLYLAEIDDKVIVKIGPRFGASQLIPGGFQVVAHGN
GYAVWEKI

BLAST