GenomeNet

>sbi:SORBI_05g003480 SORBIDRAFT_05g003480, Sb05g003480; hypothetical protein; K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] (A)
MAPTVMASSATAVAPFQGLKSTATLPVARRSTTSLAKVSNGGRIRCMQVWPAYGNKKFET
LSYLPPLTEEQLLKQVDYLLRNNWVPCLEFSKEGFVYRENSTSPCYYDGRYWTMWKLPMF
GCTDASQVYKELQEAIASYPDAYVRILGFDNIKQTQCVSFIAYKPAGSE

BLAST