GenomeNet

>sbi:SORBI_06g015420 SORBIDRAFT_06g015420, Sb06g015420; hypothetical protein; K06067 histone deacetylase 1/2 [EC:3.5.1.98] (A)
MLEKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLSYGLHKKMEIYRPHKAYPIEL
AQFHSADYVEFLHRITPDTQHLYASELTRYNLGEDCPVFDNLFEFCQIYTGGTLDAARRL
NHKTCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVE
EAFYFTDRVMTVSFHKYGDLFFPGTGDIKDIGEREGKYYAINIPLKDGIDDSSFTRLFKT
IIAKVIETYLPGAIVLQCGADSLARDRLGCFNLSIEGHAECVKFVKKFNIPLLVTGGGGY
TKENVARCWAVETGVLLDTELPNEIPNNEYIEYFAPDYTLKVPNLNMDNLNSKTYLSSIK
VQVMESLRSIQHAPGVQMQEVPPDFYIPDFDEDELDPDERVDQHTQDKQIHRDDEYYEGD
NDNDHDDGAR

BLAST