GenomeNet

>sbi:SORBI_06g018050 SORBIDRAFT_06g018050, Sb06g018050; hypothetical protein; K01580 glutamate decarboxylase [EC:4.1.1.15] (A)
MALSTANTNAAESHLHCSTFASRYVRTALPRFKMPEQSIPKEAAYQIINDELMLDGNPRL
NLASFVTTWMEPECDKLIQSSINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPIGDDETA
VGVGTVGSSEAIMLAGLAFKRKWQNKMKAAGKPYDKPNIVTGANVQVCWEKFARYFEVEL
KEVKLREGYYVMDPEKAAEMVDENTICVAAILGSTLNGEFEDVKMLNDLLAAKNAETGWD
TPIHVDAASGGFIAPFIYPELEWDFRLPLVKSINVSGHKYGLVYAGVGWVIWRSKDDLPD
ELIFHINYLGADQPTFTLNFSKGSSQIIAQYYQLIRLGFEGYKDVMQNCRDNATVLREGI
EKMGYFDVVSKDSGVPLVAFSLKDSSKYTVFEVAESLRRFGWIVPAYTMPADAEHVAVMR
VVIREDFSRGLAERLIADLGKTMADMDAHAGKKAPDHPKKSVHDIEKEVTTFWRRLVANN
KKKSSMVC

BLAST