GenomeNet

>sbi:SORBI_06g018130 K01580 glutamate decarboxylase [EC:4.1.1.15] | (RefSeq) SORBIDRAFT_06g018130, Sb06g018130; hypothetical protein (A)
MVLTHVHDLDDAAAASAVVFASRYVQDPLPRYELGEKSISKDAAYQIIHDELLLDSSPRL
NLASFVTTWMEPECDRLILEGINKNYADMDEYPVTTELQNRCVNIIARLFHAPAVGASSD
GKAVGVGTVGSSEAIMLAGLAFKRRWQNRRKAAGKPYDKPNIVTGANVQVCWEKFARYFE
VELKEVKLREGCYVMDPDEAVRMVDENTICVAAILGSTLTGEFEDVKMLNDLLAAKNAET
GWDTPIHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGVGWVIWRSKED
LPEDLIFHINYLGADQPTFTLNFSKGSSQIIAQYYQFLRLGFEGYRNVMENCMESAQTLR
EGLEQMGRFTIISKEQGVPLVAFTFKSKDETSLAFKLSSELRRYGWIVPAYTMPANLEHM
AVLRVVVWEDFGRPLAERFLSHVRMALEELDHAAKGGPVPRMRVTIELGPPDRGSGEEAS
ARVVKREAVVVPVHRSVSLSGGKTKGVC

BLAST