GenomeNet

>sbi:SORBI_06g019610 K00850 6-phosphofructokinase 1 [EC:2.7.1.11] | (RefSeq) SORBIDRAFT_06g019610, Sb06g019610; hypothetical protein (A)
MDPTAARSSGGTPAAAENDATAPTNTTVTLPPLTLRDVPRLPSALASAASPSPTPAVQNP
ISRHPYFHPPATFYISPGDVTLRHAFFDLASAAPSPLVAYRRAGPRGEIAVDPAAARAAL
VTCGGLCPGLNTVLRELVVGLHELYGVRHVFGVAAGYRGFYGTDEDHVRLDPAAVDDWHK
KGGTVLKTTRGGFDLGKIVDGIVARGYTQIYAIGGDGTMRGAVAIFQEFKRRGLNISITG
IPKTVDNDIGIIDRSFGFQTAVEIAQQAIDAAHVEAVSAVNGVGLVKLMGRSTGHIALHA
TLSSRDVDCCLIPEVDFHLEGKGGLFEFLYERIKKKGHAVIVVAEGAGQELIPRTDDQKR
EQDESGNIVFLDVGPWLKSELGRWWKREHPDELFTVKYIDPTYMIRAVPANATDNLYCTL
LAHSAIHGVMAGFTGFVPGPVNGTYSYIPLEDVAVAKNPVDVNDHKWAWVRSVTNQPDFL
KSQA

BLAST