GenomeNet

>sbi:SORBI_06g019610 SORBIDRAFT_06g019610, Sb06g019610; hypothetical protein; K00850 6-phosphofructokinase 1 [EC:2.7.1.11] (A)
MDPTAARSSGGTPAAAENDATAPTNTTVTLPPLTLRDVPRLPSALASAASPSPTPAVQNP
ISRHPYFHPPATFYISPGDVTLRHAFFDLASAAPSPLVAYRRAGPRGEIAVDPAAARAAL
VTCGGLCPGLNTVLRELVVGLHELYGVRHVFGVAAGYRGFYGTDEDHVRLDPAAVDDWHK
KGGTVLKTTRGGFDLGKIVDGIVARGYTQIYAIGGDGTMRGAVAIFQEFKRRGLNISITG
IPKTVDNDIGIIDRSFGFQTAVEIAQQAIDAAHVEAVSAVNGVGLVKLMGRSTGHIALHA
TLSSRDVDCCLIPEVDFHLEGKGGLFEFLYERIKKKGHAVIVVAEGAGQELIPRTDDQKR
EQDESGNIVFLDVGPWLKSELGRWWKREHPDELFTVKYIDPTYMIRAVPANATDNLYCTL
LAHSAIHGVMAGFTGFVPGPVNGTYSYIPLEDVAVAKNPVDVNDHKWAWVRSVTNQPDFL
KSQA

BLAST