GenomeNet

>sbi:SORBI_06g020610 SORBIDRAFT_06g020610, Sb06g020610; hypothetical protein; K07739 elongator complex protein 3 [EC:2.3.1.48] (A)
MATAAAAAVAAPEQPRRRKPAPGRGGVALPAGISEEEARVRAIAEIVSAMGELSRRGEDV
DLNALKSAACRRYGLARAPKLVEMIAAVPEADRAALLPRLRAKPVRTASGIAVVAVMSKP
HRCPHIATTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYVQARSRIDQLK
RLGHSVDKVEFILMGGTFMSLPADYRDYFIRNLHDALSGHTSANVEEAICYSEHSAVKCI
GMTIETRPDYCLGPHLRQMLSYGCTRLEIGVQSTYEDVARDTNRGHTVAAVADCFCLAKD
AGFKVVAHMMPDLPNVGVERDLESFREFFESPAFRADGLKIYPTLVIRGTGLYELWKTGR
YRNYPPELLVDIVARILSMVPPWTRVYRVQRDIPMPLVTSGVEKGNLRELALARMEDLGL
KCRDVRTREAGIQDIHHKIRPDEVELVRRDYAANEGWETFLSYEDTRQDILIGLLRLRKC
GRNVTCPELVGRCSIVRELHVYGTAVPVHGRDVDKLQHQGYGTLLMEEAERIAQKEHRSK
KLAVISGVGTRHYYRKLGYELEGPYMVKTLA

BLAST