GenomeNet

>sbi:SORBI_06g022050 K00031 isocitrate dehydrogenase [EC:1.1.1.42] | (RefSeq) SORBIDRAFT_06g022050, Sb06g022050; hypothetical protein (A)
MRNLLLPRRLLSAPTMARASVSGSAAAAKALLPLNPVRGGRLPSLLPARLPVPGSARVLR
GASLRCYAAAAAVAEQSRIKVQNPIVEMDGDEMTRVIWKLIKDKLIFPYLELDVKYYDLG
ILNRDATNDEVTVESAEATLKYNVAVKCATITPDETRVKEFKLKSMWRSPNGTIRNILNG
TVFREPILCKNIPRILSGWKKPICIGRHAFGDQYRATDMIINGPGKLKMVFVPDGADPME
LDVYDFKGPGVALSMYNVDESIRAFAESSMAMALSKKWPLYLSTKNTILKKYDGRFKDIF
QEVYEEQWKEKFEANSIWYEHRLIDDMVAYAVKSDGGYVWACKNYDGDVQSDFLAQGFGS
LGLMTSVLLSSDGKTLEAEAAHGTVTRHFRLHQKGQETSTNSIASIFAWTRGLEHRAKLD
KNDSLLDFTHKLESACVETVESGKMTKDLALLIHGPKVTREFYLSTEEFIDAVAQQLRGK
IQLPTMV

BLAST