GenomeNet

>sbi:SORBI_06g027820 SORBIDRAFT_06g027820, Sb06g027820; hypothetical protein; K10777 DNA ligase 4 [EC:6.5.1.1] (A)
MAAKVRFSLLVAMFQAMSGDKSSAKKRSRLRAFLDRAYVPSGGRDDYFSALRLVLPGLDR
ERGTYGLKEATLAAVLVDALGIAKDSADAVRLTNWRRGGGFRNAGNFGLVAAEVLQRRQG
LTSGGLTIKEVNDALDRLAATENRSEKASILSNLIKKTNAAEMKWLLMIILKDLKLGISE
KSIFEEFHPDAQDLFNVTCDLKFVCEKLNDRSQRHKRQDIEIGKAVRPQLAMRVRDASAA
WKKLHGKQVVAECKFDGDRIQIHKNGEEIHFFSRCILDGEMLVWDTVLNRFAEFGSNQEI
AKAAREGLETDRQRCIDVAFDILYAGDTSVIHQSLTERHQILQKVVKPLKGHLEILIPTG
GLNVRRPSDEPCWSIIAHNVEDVERFFKETIENRDEGIILKDLDSKWEPGDRNGKWLKLK
PDYIHAGADLDVIIIGGYYGSGRRGREVAQFLVGLAVPSDDNSYPKRFLSFCRVGTGLSD
EERDALVTKLKPYFRKNEYPKKPPKFYEVTNNSKERPDVWIESPDKSVIISVTSDIRTIK
SEVFASPYCLRFPRIQRVRYDKPWHECLDVQAFVDIVHSSNGTTQRVADDNSLKNDDTNR
SRTNKKVEKKKCVSVIPSHLMKTDVSVVENGGSFSMNLNDSVTHCIAAEKKGIKYQAALR
QGRIIHYEWILDCCKEKHLLRLQPRYILFLADFARHKFPEEIDSYADYYYWDIEIADLKQ
IFSNIDKVAGDSNMVNQYKKKHCIDERFCFFQGCCVYLHNAPLVNADYNVISDLALKRVK
QDLTMHGGQVCSSIAPATHLVVVSVLQAYNFDNLYKSFPPAERRYLHDKRLHVVSNKWLE
DSVEKQMKLSETAYSLKPDTLEELEIERSEENVQPPDHKLEEHREVERSHAKNVPRKRTR
PTSSRTARAAPRPVRRMRPRRGNQKAKIGDDVESEESGPSECQDDQNLDTDDTSKIEEGI
TSKKKGLPPPASKPARRTRAARGNQHTKIDDGGSEESGPCETGQDDQKLDTDYISNMEVD
NSDKDCGPPPGAQLFTLGEQEAKGVKLNTVEEKPDSPFQRTTAAEAMSSAPGDKIEQMAD
PLHAMLLDMLPLLGKKGTEDASRAPLPKAEKDPPAGGSSTSNSEILAPDAGTSGVPAPDP
NAAPPPKKKKVSYKDVASELLKDW

BLAST